Bioactive grade

Recombinant human HBEGF/DTR protein (Animal Free) (ab205523)

Description

  • Product name

    Recombinant human HBEGF/DTR protein (Animal Free)
    See all HBEGF/DTR proteins and peptides
  • Biological activity

    The activity is determined by the ability to induce proliferation of 3T3 cells and is typically less than 0.2 ng/mL. This corresponds to an expected specific activity of 5 x 106 units/mg.

  • Purity

    > 97 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKY KDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
    • Predicted molecular weight

      10 kDa
    • Amino acids

      63 to 148
    • Additional sequence information

      This is the full length protein without the signal peptide and propeptide.

Specifications

Our Abpromise guarantee covers the use of ab205523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as HB EGF

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the sterile water down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.

General Info

  • Alternative names

    • Diphtheria toxin receptor
    • diphtheria toxin receptor (heparin-binding EGF-like growth factor)
    • diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor)
    • DT R
    • DT-R
    • DTR
    • DTS
    • DTSF
    • HB-EGF
    • HBEGF
    • HBEGF_HUMAN
    • HEGFL
    • Heparin binding EGF like growth factor
    • Heparin binding epidermal growth factor
    • Heparin binding epidermal growth factor like growth factor
    • Heparin-binding EGF-like growth factor
    • Proheparin binding EGF like growth factor
    see all
  • Function

    May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts and smooth muscle but not endothelial cells. It is able to bind EGF receptors with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Post-translational
    modifications

    Several N-termini have been identified by direct sequencing. The forms with N-termini 63, 73 and 74 have been tested and found to be biologically active.
    O-linked glycan attachment sites were determined by Edman degradation, O-glycanase digest suggests mucin-type glycosylation (done in HB-EGF purified from histiocytic lymphoma cell line U-937).
  • Cellular localization

    Cell membrane and Secreted > extracellular space. Mature HB-EGF is released into the extracellular space and probably binds to a receptor.
  • Information by UniProt

References

ab205523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up