Description

  • Product name

    Recombinant human HC-II protein
    See all HC-II proteins and peptides
  • Biological activity

    Measured by its ability to inhibit Recombinant Human Coagulation Factor II/Thrombin cleavage of a fluorogenic peptide substrate Boc-VPR-AMC. The IC50 value is <1.8 nM.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDW IPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHG KSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGL KGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLR SVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKL TKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNERE VVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTL EAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFD KNGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRF TVDRPFLFLIYEHRTSCLLFMGRVANPSRS
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      20 to 499
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein with out the signal peptide. (Accession # AAH35028)

Specifications

Our Abpromise guarantee covers the use of ab191977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Protein previously labeled as Heparin Cofactor II.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C long term. Please see notes section.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a stock solution of 100ug/ml. After reconstitution store under sterile conditions at -70 degrees.

General Info

  • Alternative names

    • D22S673
    • HC II
    • HC-II
    • HC2
    • HCF2
    • HEP2_HUMAN
    • Heparin cofactor 2
    • Heparin cofactor II
    • HLS2
    • Leuserpin 2
    • LS2
    • Protease inhibitor leuserpin 2
    • Protease inhibitor leuserpin-2
    • serine (or cysteine) proteinase inhibitor, clade D (heparin cofactor), member 1
    • Serpin D1
    • serpin peptidase inhibitor, clade D (heparin cofactor), member 1
    • SERPIND1
    • THPH10
    see all
  • Function

    Thrombin inhibitor activated by the glycosaminoglycans, heparin or dermatan sulfate. In the presence of the latter, HC-II becomes the predominant thrombin inhibitor in place of antithrombin III (AT-III). Also inhibits chymotrypsin, but in a glycosaminoglycan-independent manner.
    Peptides at the N-terminal of HC-II have chemotactic activity for both monocytes and neutrophils.
  • Tissue specificity

    Expressed predominantly in liver. Also present in plasma.
  • Involvement in disease

    Thrombophilia due to heparin cofactor 2 deficiency
  • Sequence similarities

    Belongs to the serpin family.
  • Domain

    The N-terminal acidic repeat region mediates, in part, the glycosaminoglycan-accelerated thrombin inhibition.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracellular medium.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab191977 and staining overnight with Coomassie Blue.

References

ab191977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up