Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQ KNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
    • Amino acids
      25 to 116
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anterior pituitary glycoprotein hormones common subunit alpha
    • CG alpha
    • CG-alpha
    • cga
    • Choriogonadotropin alpha chain
    • Chorionic Gonadotrophin Alpha
    • Chorionic Gonadotrophin Alpha Subunit
    • Chorionic gonadotrophin subunit alpha
    • chorionic gonadotropin, alpha polypeptide
    • Follicle-stimulating hormone alpha
    • Follicle-stimulating hormone alpha chain
    • follicle-stimulating hormone alpha subunit
    • Follitropin alpha
    • Follitropin alpha chain
    • FSH Alpha
    • FSH-alpha
    • FSHA
    • GLHA_HUMAN
    • Glycoprotein hormones alpha chain
    • Glycoprotein Hormones Alpha Polypeptide
    • GPH Alpha
    • GPHa
    • GPHA1
    • HCG
    • hyrotropin alpha
    • LH-alpha
    • LHA
    • LSH alpha
    • LSH-alpha
    • Luteinizing hormone alpha
    • Luteinizing hormone alpha chain
    • Lutropin alpha
    • Lutropin alpha chain
    • Thyroid Stimulating Hormone Alpha
    • Thyroid Stimulating Hormone Alpha Chain
    • Thyroid-stimulating hormone alpha chain
    • Thyrotropin alpha chain
    • TSH Alpha
    • TSH-alpha
    • TSHA
    see all
  • Sequence similarities
    Belongs to the glycoprotein hormones subunit alpha family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158101 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up