Description

  • Product name

    Recombinant Human hCG alpha protein
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQ KNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
    • Predicted molecular weight

      12 kDa
    • Amino acids

      25 to 116
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature form without signal peptide. AAH20782

Specifications

Our Abpromise guarantee covers the use of ab201418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: PBS, 10% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 500 µL sterile deionized water to a final concentration of 0.2 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution, aliquots of less than 0.01 mg/vial, and long term storage. After reconstitution store under sterile conditions for 3 months (-70 degC).

General Info

  • Alternative names

    • Anterior pituitary glycoprotein hormones common subunit alpha
    • CG alpha
    • CG-alpha
    • cga
    • Choriogonadotropin alpha chain
    • Chorionic Gonadotrophin Alpha
    • Chorionic Gonadotrophin Alpha Subunit
    • Chorionic gonadotrophin subunit alpha
    • chorionic gonadotropin, alpha polypeptide
    • Follicle-stimulating hormone alpha
    • Follicle-stimulating hormone alpha chain
    • follicle-stimulating hormone alpha subunit
    • Follitropin alpha
    • Follitropin alpha chain
    • FSH Alpha
    • FSH-alpha
    • FSHA
    • GLHA_HUMAN
    • Glycoprotein hormones alpha chain
    • Glycoprotein Hormones Alpha Polypeptide
    • GPH Alpha
    • GPHa
    • GPHA1
    • HCG
    • hyrotropin alpha
    • LH-alpha
    • LHA
    • LSH alpha
    • LSH-alpha
    • Luteinizing hormone alpha
    • Luteinizing hormone alpha chain
    • Lutropin alpha
    • Lutropin alpha chain
    • Thyroid Stimulating Hormone Alpha
    • Thyroid Stimulating Hormone Alpha Chain
    • Thyroid-stimulating hormone alpha chain
    • Thyrotropin alpha chain
    • TSH Alpha
    • TSH-alpha
    • TSHA
    see all
  • Sequence similarities

    Belongs to the glycoprotein hormones subunit alpha family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab201418 was determined by DTT-reduced SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 22-26 kDa in SDS-PAGE due to glycosylation.

References

ab201418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up