Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQG VLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRST TDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQHH HHHH
    • Molecular weight

      17 kDa including tags
    • Amino acids

      21 to 165
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab223019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab223019 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CG beta
    • CG-beta
    • CgB
    • CGB3
    • CGB3_HUMAN
    • CGB5
    • CGB7
    • CGB7_HUMAN
    • CGB8
    • CGHB_HUMAN
    • Choriogonadotropin subunit beta
    • Choriogonadotropin subunit beta 3
    • Choriogonadotropin subunit beta 7
    • Chorionic gonadotropin beta polypeptide
    • Chorionic gonadotropin chain beta
    see all
  • Relevance

    Function: Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. Tissue specificity: Placenta. Similarity: Belongs to the glycoprotein hormones subunit beta family. Developmental stage: Made by the first trimester placenta.

Images

  • 15% SDS-PAGE - Recombinant Human hCG beta protein (His tag) (3 µg ab223019).

    18-28 kDa under reducing conditions.

References

ab223019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up