Description

  • Product name

    Recombinant Human Hck protein
    See all Hck proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGCMKSKFLQVGGNTSSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLA TRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIR DSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQE LVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAG QFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLH AVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAF IEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPI KWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGVSNPEVIRALE RGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQ YQQQP
    • Predicted molecular weight

      81 kDa including tags
    • Amino acids

      1 to 505
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bmk
    • Hck
    • Hck 1
    • HCK_HUMAN
    • Hemopoietic cell kinase
    • JTK9
    • p59-HCK/p60-HCK
    • p59Hck
    • p59HCK/p60HCK
    • p61Hck
    • Tyrosine protein kinase HCK
    • Tyrosine-protein kinase HCK
    see all
  • Function

    May serve as part of a signaling pathway coupling the Fc receptor to the activation of the respiratory burst. May also contribute to neutrophil migration and may regulate the degranulation process of neutrophils.
  • Tissue specificity

    Expressed predominantly in cells of the myeloid and B-lymphoid lineages.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain mediates binding to HIV-1 Nef.
  • Cellular localization

    Membrane. Cytoplasm. At least half of this isoform is found in the cytoplasm, some of this fraction is myristoylated and Membrane. Membrane > caveola. 20% of this isoform is associated with caveolae, this association depends on palmitoylation of cyteine at position 3.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131827 stained with Coomassie Blue.

References

ab131827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up