Description

  • Product name

    Recombinant Human HCM protein
  • Purity

    > 90 % SDS-PAGE.
    ab108376 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMANSAKAEEYEKMSLEQAKASVNSETESSF NINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKESSSCGKDTPSK KRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIA LEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIAD VSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEA SETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNE MAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLV SEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      1 to 476
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • DKFZp686H1252
    • EC 2.1.1.56
    • hcm1p
    • hCMT1
    • HCMT1a
    • hCMT1c
    • hMet
    • hypothetical protein KIAA0396
    • KIAA0398
    • MCES_HUMAN
    • MET
    • mRNA (guanine 7)methyltransferase
    • mRNA (guanine N(7)) methyltransferase
    • mRNA (guanine-N(7)-)-methyltransferase
    • mRNA cap guanine-N7 methyltransferase
    • mRNA cap methyltransferase
    • OTTHUMP00000162509
    • RG7MT1
    • RNA (guanine 7) methyltransferase
    • RNA guanine 7 methyltransferase
    • Rnmt
    see all
  • Function

    mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. mRNA cap methyltransferase family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab108376 (3µg)

References

ab108376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up