Recombinant Human HDAC11 protein (ab101113)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLK EEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIF LPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYI MDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHL PDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 347

Specifications

Our Abpromise guarantee covers the use of ab101113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    52 RLU/min/ng
  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity
    > 75 % SDS-PAGE.
    The purity was determined to be >75% by densitometry
  • Form
    Liquid
  • Additional notes
    52 RLU/min/ng
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.307% Glutathione, 0.00174% PMSF, 0.00385% DTT, 0.79% Tris HCl, 0.00292% EDTA, 25% Glycerol, 0.87% Sodium chloride

General Info

  • Alternative names
    • FLJ22237
    • HD 11
    • HD11
    • HDA11_HUMAN
    • HDAC 11
    • HDAC11
    • Histone deacetylase 11
    see all
  • Function
    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
  • Tissue specificity
    Weakly expressed in most tissues. Strongly expressed in brain, heart, skeletal muscle, kidney and testis.
  • Sequence similarities
    Belongs to the histone deacetylase family.
  • Cellular localization
    Nucleus. Predominantly nuclear.
  • Information by UniProt

Images

  • The putity of ab101113 was determined to be >75% by densitometry.

    Approximate MWt: 66kDa
  • The specific activity of ab101113 was determined to be 52 RLU/min/ng.

References

ab101113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up