Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDPMGHHHHHHGRRRASVAAGILVPRGSPGLD GIYARGIQMTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPR SIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDE QLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELM LVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVL RLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKH RIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNW STTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVA AGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALA EGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRST ETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNH CNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSA EYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEA VLSGEVLNGAAVVRPPGHAAEQDAACGFCFFNSVAVAARHAQTISGHALR ILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIG RAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFD AARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEGGYNLTSISESMA ACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVEDR EGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEEST PGQTNSETAVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEA VGGATPDQTTSEETVGGAILDQTTSEDAVGGATLGQTTSEEAVGGATLAQ TTSEAAMEGATLDQTTSEEAPGGTELIQTPLASSTDHQTPPTSPVQGTTP QISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSMLM QGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQEN WVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHH QALLDVKNIAHQNKFGEDMPHPH
    • Molecular weight

      161 kDa including tags
    • Amino acids

      1 to 1215
    • Modifications

      mutated H611 A
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 7.5 pmole/min

    Assay conditions: 25 mM Tris/HCl, pH 8.0, 137 mM NaCl, 2.7 mM KCl, 1 mM MgCl2, and 0.1 mg/ml BSA, 20 µM BPS HDAC substrate 3, and HDAC6 H611A (15.6 - 1000ng). Incubation condition: 30 min at 37°C followed by HDAC developer for 15 min at room temperature. Fluorescence intensity is measured at ex360/em460.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 79 % SDS-PAGE.
    Protein was purified by affinity chromatography and gel filtration.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.03% DTT, 0.38% Potassium chloride, 0.79% Sodium chloride, 0.06% EDTA, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CPBHM
    • FLJ16239
    • HD 6
    • HD6
    • HDAC 6
    • HDAC6
    • HDAC6_HUMAN
    • Histone deacetylase 6
    • Histone deacetylase 6 (HD6)
    • JM 21
    • JM21
    • KIAA0901
    • OTTHUMP00000032398
    • OTTHUMP00000197663
    • PPP1R90
    • Protein phosphatase 1 regulatory subunit 90
    see all
  • Function

    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
  • Sequence similarities

    Belongs to the histone deacetylase family. HD type 2 subfamily.
    Contains 1 UBP-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated. Its polyubiquitination however does not lead to its degradation.
    Sumoylated in vitro.
  • Cellular localization

    Nucleus. Cytoplasm. It is mainly cytoplasmic, where it is associated with microtubules.
  • Information by UniProt

Images

  • Activity assay using ab198058.

  • 4-20% SDS-PAGE analysis of 3 µg ab198058 with Coomassie staining.

References

ab198058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up