Description

  • Product name

    Recombinant Human HDAC6 protein (Tagged)
    See all HDAC6 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEV KKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCL WDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYI DLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLG AEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIV DWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQG DPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLH TLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNM EEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 488
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • CPBHM
    • FLJ16239
    • HD 6
    • HD6
    • HDAC 6
    • HDAC6
    • HDAC6_HUMAN
    • Histone deacetylase 6
    • Histone deacetylase 6 (HD6)
    • JM 21
    • JM21
    • KIAA0901
    • OTTHUMP00000032398
    • OTTHUMP00000197663
    • PPP1R90
    • Protein phosphatase 1 regulatory subunit 90
    see all
  • Function

    Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
  • Sequence similarities

    Belongs to the histone deacetylase family. HD type 2 subfamily.
    Contains 1 UBP-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated. Its polyubiquitination however does not lead to its degradation.
    Sumoylated in vitro.
  • Cellular localization

    Nucleus. Cytoplasm. It is mainly cytoplasmic, where it is associated with microtubules.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226403 with 5% enrichment gel and 15% separation gel.

References

ab226403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up