Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFF GTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGY QSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE KGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNST PSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
    • Molecular weight

      53 kDa
    • Amino acids

      1 to 240

Specifications

Our Abpromise guarantee covers the use of ab132259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ96580
    • HDGF
    • HDGF_HUMAN
    • Hepatoma derived growth factor
    • Hepatoma-derived growth factor
    • High mobility group protein 1 like 2
    • High mobility group protein 1-like 2
    • HMG-1L2
    • HMG1L2
    see all
  • Function

    Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Domain

    The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.
  • Post-translational
    modifications

    Sumoylated by SUMO1. Sumoylation prevents binding to chromatin.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132259 stained with Coomassie Blue.

References

ab132259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up