Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFF GTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGY
    • Molecular weight
      13 kDa including tags
    • Amino acids
      1 to 100
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Sequence for the tag: LEHHHHHH

Specifications

Our Abpromise guarantee covers the use of ab173057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab173057 is greater than 95% ,as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.24% Tris, 0.03% EDTA, 0.02% DTT

General Info

  • Alternative names
    • FLJ96580
    • HDGF
    • HDGF_HUMAN
    • Hepatoma derived growth factor
    • Hepatoma-derived growth factor
    • High mobility group protein 1 like 2
    • High mobility group protein 1-like 2
    • HMG-1L2
    • HMG1L2
    see all
  • Function
    Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Domain
    The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.
  • Post-translational
    modifications
    Sumoylated by SUMO1. Sumoylation prevents binding to chromatin.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab173057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up