Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAYGMPMYKSGDLVFAKLKGYAHWPARIEHMTQPNRYQVFFFGTHETAF LSPKRLFPYKECKEKFGKPNKRRGFSAGLWEIENNPTVQASDCPLASEKG SGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAG DPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVA VENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDS L
    • Amino acids
      1 to 251
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ309H15.1
    • HDGF (hepatoma-derived growth factor) like
    • HDGFL1
    • HDGL1_HUMAN
    • Hepatoma-derived growth factor-like protein 1
    • PWWP domain-containing protein 1
    • PWWP1
    see all
  • Sequence similarities
    Belongs to the HDGF family.
    Contains 1 PWWP domain.
  • Information by UniProt

Images

  • ab165677 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up