Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSC PQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
    • Molecular weight

      36 kDa including tags
    • Amino acids

      31 to 124

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • dJ461P17.6
    • EDDM4
    • epididymal protein 4
    • Epididymal secretory protein E4
    • Epididymis specific whey acidic protein type four disulfide core
    • HE 4
    • Major epididymis specific protein E4
    • Major epididymis-specific protein E4
    • MGC57529
    • Putative protease inhibitor WAP5
    • WAP 5
    • WAP domain containing protein HE4
    • WAP domain containing protein HE4 V4
    • WAP four disulfide core domain 2
    • WAP four disulfide core domain protein 2
    • WAP four-disulfide core domain protein 2
    • WAP5
    • WFDC 2
    • WFDC2
    • WFDC2_HUMAN
    see all
  • Tissue specificity

    Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.
  • Sequence similarities

    Contains 2 WAP domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132299.

References

This product has been referenced in:

  • James NE  et al. HE4 suppresses the expression of osteopontin in mononuclear cells and compromises their cytotoxicity against ovarian cancer cells. Clin Exp Immunol 193:327-340 (2018). Read more (PubMed: 29745428) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up