Description

  • Product name

    Recombinant Human HE4 protein
    See all HE4 proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV TPNF
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      31 to 124
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab184603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry

    LC-MS/MS
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 100% PBS

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and allow the lyophilised pellet to dissolve completely.

General Info

  • Alternative names

    • dJ461P17.6
    • EDDM4
    • epididymal protein 4
    • Epididymal secretory protein E4
    • Epididymis specific whey acidic protein type four disulfide core
    • HE 4
    • Major epididymis specific protein E4
    • Major epididymis-specific protein E4
    • MGC57529
    • Putative protease inhibitor WAP5
    • WAP 5
    • WAP domain containing protein HE4
    • WAP domain containing protein HE4 V4
    • WAP four disulfide core domain 2
    • WAP four disulfide core domain protein 2
    • WAP four-disulfide core domain protein 2
    • WAP5
    • WFDC 2
    • WFDC2
    • WFDC2_HUMAN
    see all
  • Tissue specificity

    Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.
  • Sequence similarities

    Contains 2 WAP domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab184603.

    Lane 1: Reduced and boiled HE4, 2.5 µg/lane

    Lane 2: Non-reduced and non-boiled HE4, 2.5 µg/lane

References

This product has been referenced in:

  • James NE  et al. Human Epididymis Secretory Protein 4 (HE4) Compromises Cytotoxic Mononuclear Cells via Inducing Dual Specificity Phosphatase 6. Front Pharmacol 10:216 (2019). Read more (PubMed: 30941033) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up