Description

  • Product name

    Recombinant Human HE4 protein (His tag)
    See all HE4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSC PQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      31 to 124
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab219658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 5% Trehalose, PBS

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • dJ461P17.6
    • EDDM4
    • epididymal protein 4
    • Epididymal secretory protein E4
    • Epididymis specific whey acidic protein type four disulfide core
    • HE 4
    • Major epididymis specific protein E4
    • Major epididymis-specific protein E4
    • MGC57529
    • Putative protease inhibitor WAP5
    • WAP 5
    • WAP domain containing protein HE4
    • WAP domain containing protein HE4 V4
    • WAP four disulfide core domain 2
    • WAP four disulfide core domain protein 2
    • WAP four-disulfide core domain protein 2
    • WAP5
    • WFDC 2
    • WFDC2
    • WFDC2_HUMAN
    see all
  • Tissue specificity

    Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis.
  • Sequence similarities

    Contains 2 WAP domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE using ab219658. DTT-reduced protein migrates at 19 kDa and 22-26 kDa due to different glycosylation.

References

ab219658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up