Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELT RNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLYLNTHTAL EQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVRLGRRPTYVEL DVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLY NKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFE VDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQL KLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFT VLSPAPRPLPKNFLLIMDIRFMDLK
    • Amino acids
      1 to 425
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP/GTP binding protein
    • Cleavage and polyadenylation factor I subunit 1
    • CLP 1
    • clp1
    • CLP1 cleavage and polyadenylation factor I subunit homolog
    • CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae)
    • CLP1, yeast, homolog of
    • CLP1_HUMAN
    • hClp1
    • Homolog of yeast CFIA subunit Clp1p
    • Polyadenylation factor Clp1
    • Polynucleotide kinase Clp1
    • Polyribonucleotide 5' hydroxyl kinase Clp1
    • Polyribonucleotide 5''-hydroxyl-kinase Clp1
    • Pre mRNA cleavage complex II protein Clp1
    • Pre-mRNA cleavage complex II protein Clp1
    see all
  • Function
    Polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Appears to have roles in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex. Phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA. Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA-induced silencing complex (RISC). However endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing.
  • Sequence similarities
    Belongs to the Clp1 family. Clp1 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161223 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up