Description

  • Product name

    Recombinant Human Heat Shock Factor 2 Binding Protein
  • Purity

    > 85 % SDS-PAGE.
    ab183220 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGEAGAAEEACRHMGTKEEFVKVRKKD LERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMD CEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAA CTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDS DESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCT KLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLR LVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDL RTLEHNV
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      1 to 334
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_008962

Specifications

Our Abpromise guarantee covers the use of ab183220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride, 30% Glycerol, 0.03% DTT

General Info

  • Alternative names

    • heat shock transcription factor 2 binding protein
    • HSF2 binding protein
    • HSF2BP
  • Relevance

    Heat Shock Factor 2 Binding Protein (HSF2BP) associates with Heat Shock Factor 2 (HSF2). The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab183220 (3μg).

References

ab183220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up