Overview

  • Product name

    Recombinant Human HEC1/HEC protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTS ERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLC EFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEE VPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKE SSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAEL QSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELK YARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCL VKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSV RTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGL SEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 642

Specifications

Our Abpromise guarantee covers the use of ab131907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as HEC1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • from Entrez Gene ;
    • HEC
    • Highly expressed in cancer
    • Highly expressed in cancer protein
    • Highly expressed in cancer rich in leucine heptad repeats
    • HsHec1
    • hsNDC80
    • Kinetochore associated 2
    • Kinetochore associated protein 2
    • Kinetochore protein Hec1
    • Kinetochore protein NDC80 homolog
    • Kinetochore-associated protein 2
    • KNTC2
    • ndc80
    • NDC80 homolog kinetochore complex component
    • NDC80 kinetochore complex component homolog
    • NDC80, S. cerevisiae, homolog of
    • NDC80_HUMAN
    • Retinoblastoma associated protein HEC
    • Retinoblastoma-associated protein HEC
    • TID3
    see all
  • Function

    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities

    Belongs to the NDC80/HEC1 family.
  • Developmental stage

    Expression peaks in mitosis.
  • Post-translational
    modifications

    Phosphorylation begins in S phase of the cell cycle and peaks in mitosis. Phosphorylated by NEK2. May also be phosphorylated by AURKA and AURKB.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131907 stained with Coomassie Blue.

References

ab131907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up