Description

  • Product name

    Recombinant Human HECTD1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRT FLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKAL CNRLVVVE
    • Amino acids

      3 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ligase for inhibin receptor
    • E3 ubiquitin protein ligase HECTD1
    • E3 ubiquitin-protein ligase HECTD1
    • EULIR
    • HECD1_HUMAN
    • HECT domain containing protein 1
    • HECT domain-containing protein 1
    • HECTD1
    • KIAA1131
    see all
  • Function

    Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. May be required for development of the head mesenchyme and neural tube closure.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the UPL family. K-HECT subfamily.
    Contains 4 ANK repeats.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 1 MIB/HERC2 domain.
  • Information by UniProt

Images

  • ab161805 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up