Description

  • Product name

    Recombinant Human HEMK2/N6AMT1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab187466 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAE DTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTD INPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVV TPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKEN NPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 214
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_037372

Specifications

Our Abpromise guarantee covers the use of ab187466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as HEMK2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • C21orf127
    • Chromosome 21 open reading frame 127
    • EC 2.1.1.-
    • HemK methyltransferase family member 2
    • HemK2
    • M.HsaHemK2P
    • MGC19995
    • MTQ2
    • N-6 adenine-specific DNA methyltransferase 1
    • N-6 adenine-specific DNA methyltransferase 1 (putative)
    • N6-DNA-methyltransferase
    • N6AMT
    • N6AMT1
    • OTTHUMP00000096393
    • OTTHUMP00000096394
    • PRED28
    see all
  • Relevance

    The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Images

  • 15% SDS-PAGE analysis of ab187466 (3μg).

References

ab187466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up