Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSTPLPPTSAHGNVAEGETKPDPDVTERC SDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAA FRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECH RGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYC FQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHH GPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPH EKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQ PQNVTSLLGCTH
    • Molecular weight

      52 kDa including tags
    • Amino acids

      24 to 462
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000604

Specifications

Our Abpromise guarantee covers the use of ab177679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • Beta 1B glycoprotein
    • Beta-1B-glycoprotein
    • FLJ56652
    • HEMO
    • HEMO_HUMAN
    • Hemopexin
    • Hpx
    • HX
    see all
  • Function

    Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the hemopexin family.
    Contains 5 hemopexin-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab177679 (3 µg) at approximately 51.7 kDa.

References

ab177679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up