Description

  • Product name

    Recombinant Human HEPACAM protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSI GTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTG EKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKD GKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKI TVYRRSSVDHHHHHH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      34 to 240
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • FLJ25530
    • GlialCAM
    • HECAM_HUMAN
    • HEPACAM
    • Hepatocyte cell adhesion molecule
    • Protein hepaCAM
    see all
  • Function

    Involved in regulating cell motility and cell-matrix interactions. May inhibit cell growth through suppression of cell proliferation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cytoplasm. Membrane. In MCF7 breast carcinoma and hepatic Hep3B and HepG2 cell lines, localization of HEPACAM is cell density-dependent. In well spread cells, localized to punctate structures in the perinuclear membrane, cytoplasm, and at cell surface of protusions. In confluent cells, localized predominantly to the cytoplasmic membrane, particularly in areas of cell-cell contacts. Colocalizes with CDH1.
  • Information by UniProt

References

ab151670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up