For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-heparan-sulfate-proteoglycan-2perlecan-protein-tagged-ab114285.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Adhesion / ECM Extracellular Matrix
Share by email

Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (Tagged) (ab114285)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (ab114285)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: ELISA, SDS-PAGE, WB

    Description

    • Product name

      Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (Tagged)
      See all Heparan Sulfate Proteoglycan 2/Perlecan proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      P98160
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDL GSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYL KIPGDQVVSV
      • Predicted molecular weight

        38 kDa including tags
      • Amino acids

        25 to 134
      • Tags

        GST tag N-Terminus

    Associated products

    • Related Products

      • Anti-GST antibody [EPR4236] (ab111947)
      • Anti-GST antibody (ab19256)
      • Anti-GST antibody (ab9085)

    Specifications

    Our Abpromise guarantee covers the use of ab114285 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      SDS-PAGE

      Western blot

    • Form

      Liquid
    • Additional notes

      Protein concentration is above or equal to 0.05 µg/µL.

      This product was previously labelled as Heparan Sulfate Proteoglycan 2.

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • Basement membrane specific heparan sulfate proteoglycan core protein
      • Endorepellin (domain V region)
      • Heparan sulfate proteoglycan of basement membrane
      • HSPG
      • HSPG 2
      • Hspg2
      • LG3 peptide
      • Perlecan
      • PGBM_HUMAN
      • PLC
      • Schwartz Jampel syndrome 1 (chondrodystrophic myotonia)
      • SJA
      • SJS
      • SJS1
      see all
    • Function

      Integral component of basement membranes. Component of the glomerular basement membrane (GBM), responsible for the fixed negative electrostatic membrane charge, and which provides a barrier which is both size- and charge-selective. It serves as an attachment substrate for cells. Plays essential roles in vascularization. Critical for normal heart development and for regulating the vascular response to injury. Also required for avascular cartilage development.
      Endorepellin in an anti-angiogenic and anti-tumor peptide that inhibits endothelial cell migration, collagen-induced endothelial tube morphogenesis and blood vessel growth in the chorioallantoic membrane. Blocks endothelial cell adhesion to fibronectin and type I collagen. Anti-tumor agent in neovascularization. Interaction with its ligand, integrin alpha2/beta1, is required for the anti-angiogenic properties. Evokes a reduction in phosphorylation of receptor tyrosine kinases via alpha2/beta1 integrin-mediated activation of the tyrosine phosphatase, PTPN6.
      The LG3 peptide has anti-angiogenic properties that require binding of calcium ions for full activity.
    • Tissue specificity

      Found in the basement membranes.
    • Involvement in disease

      Defects in HSPG2 are the cause of Schwartz-Jampel syndrome (SJS1) [MIM:255800]; a rare autosomal recessive disorder characterized by permanent myotonia (prolonged failure of muscle relaxation) and skeletal dysplasia, resulting in reduced stature, kyphoscoliosis, bowing of the diaphyses and irregular epiphyses.
      Defects in HSPG2 are the cause of dyssegmental dysplasia Silverman-Handmaker type (DDSH) [MIM:224410]. The dyssegmental dysplasias are rare, autosomal recessive skeletal dysplasias with anisospondyly and micromelia. There are two recognized types: the severe, lethal DDSH and the milder Rolland-Desbuquois form. Individuals with DDSH also have a flat face, micrognathia, cleft palate and reduced joint mobility, and frequently have an encephalocoele. The endochondral growth plate is short, the calcospherites (which are spherical calcium-phosphorus crystals produced by hypertrophic chondrocytes) are unfused, and there is mucoid degeneration of the resting cartilage.
    • Sequence similarities

      Contains 4 EGF-like domains.
      Contains 22 Ig-like C2-type (immunoglobulin-like) domains.
      Contains 11 laminin EGF-like domains.
      Contains 3 laminin G-like domains.
      Contains 3 laminin IV type A domains.
      Contains 4 LDL-receptor class A domains.
      Contains 1 SEA domain.
    • Post-translational
      modifications

      Proteolytic processing produces the C-terminal angiogenic peptide, endorepellin. This peptide can be further processed to produce the LG3 peptide.
      N- and O-glycosylated; contains three heparan sulfate chains. The LG3 peptide contains at least three and up to five potential O-glycosylation sites but no N-glycosylation.
    • Cellular localization

      Secreted > extracellular space > extracellular matrix > basement membrane.
    • Target information above from: UniProt accession P98160 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (ab114285)
      SDS-PAGE - Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (ab114285)
      12.5% SDS-PAGE showing ab114285 at approximately 37.73kDa stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab114285? Please let us know so that we can cite the reference in this datasheet.

    ab114285 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Dear Sir/Madam, we are looking at Human Heparan Sulfate Measurements in cultured fibroblasts. We usually use your anti-Heparan Sulfate Proteoglycan 2 antibody- A74 (ab23418) and we would like to realize a range with a recombinant HSPG2 protein in order to quantificate the HSPG2 presents in our cells.
    For that, we need to know which epitope of the HSPG2 protein is recognized by our product? Do you know, which recombinant protein could we use? We didn’t find it in the website
    I am looking forward to your reply as soon as possible. Please have a look. Thank you very much.

    Read More

    Abcam community

    Verified customer

    Asked on Mar 28 2012

    Answer

    Thank you very much for contacting us and for your patience. I apologise for the delay.

    We have contacted the originator of the Anti-Heparan Sulfate Proteoglycan 2 antibody [A74]ab23418and enquired about epitope details. Unfortunately, there are no more details available than what is already stated on the datasheet: The epitope is located in domain V of Perlecan.

    We unfortunately have only one Heparan Sulfate Proteoglycan 2 protein available in our catalog: ab114285 is a recombinant fragment of Human Heparan Sulfate Proteoglycan 2, amino acids 25-134.As thisrange of amino acids is different from domain V, ab114285 is therefore not a suitable option for your experimental setup.

    We aim to provide as much information as possible to customers, so I am sorry that this has not been possible on this occasion.Please do not hesitate to contact us again with other needs or with any questions about our products.

    Read More

    Abcam Scientific Support

    Answered on Mar 28 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.