Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (Tagged) (ab114285)

Overview

  • Product name
    Recombinant Human Heparan Sulfate Proteoglycan 2/Perlecan protein (Tagged)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDL GSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYL KIPGDQVVSV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      25 to 134
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
    Best use within three months from the date of receipt of this protein.

    This product was previously labelled as Heparan Sulfate Proteoglycan 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basement membrane specific heparan sulfate proteoglycan core protein
    • Endorepellin (domain V region)
    • Heparan sulfate proteoglycan of basement membrane
    • HSPG
    • HSPG 2
    • Hspg2
    • LG3 peptide
    • Perlecan
    • PGBM_HUMAN
    • PLC
    • Schwartz Jampel syndrome 1 (chondrodystrophic myotonia)
    • SJA
    • SJS
    • SJS1
    see all
  • Function
    Integral component of basement membranes. Component of the glomerular basement membrane (GBM), responsible for the fixed negative electrostatic membrane charge, and which provides a barrier which is both size- and charge-selective. It serves as an attachment substrate for cells. Plays essential roles in vascularization. Critical for normal heart development and for regulating the vascular response to injury. Also required for avascular cartilage development.
    Endorepellin in an anti-angiogenic and anti-tumor peptide that inhibits endothelial cell migration, collagen-induced endothelial tube morphogenesis and blood vessel growth in the chorioallantoic membrane. Blocks endothelial cell adhesion to fibronectin and type I collagen. Anti-tumor agent in neovascularization. Interaction with its ligand, integrin alpha2/beta1, is required for the anti-angiogenic properties. Evokes a reduction in phosphorylation of receptor tyrosine kinases via alpha2/beta1 integrin-mediated activation of the tyrosine phosphatase, PTPN6.
    The LG3 peptide has anti-angiogenic properties that require binding of calcium ions for full activity.
  • Tissue specificity
    Found in the basement membranes.
  • Involvement in disease
    Defects in HSPG2 are the cause of Schwartz-Jampel syndrome (SJS1) [MIM:255800]; a rare autosomal recessive disorder characterized by permanent myotonia (prolonged failure of muscle relaxation) and skeletal dysplasia, resulting in reduced stature, kyphoscoliosis, bowing of the diaphyses and irregular epiphyses.
    Defects in HSPG2 are the cause of dyssegmental dysplasia Silverman-Handmaker type (DDSH) [MIM:224410]. The dyssegmental dysplasias are rare, autosomal recessive skeletal dysplasias with anisospondyly and micromelia. There are two recognized types: the severe, lethal DDSH and the milder Rolland-Desbuquois form. Individuals with DDSH also have a flat face, micrognathia, cleft palate and reduced joint mobility, and frequently have an encephalocoele. The endochondral growth plate is short, the calcospherites (which are spherical calcium-phosphorus crystals produced by hypertrophic chondrocytes) are unfused, and there is mucoid degeneration of the resting cartilage.
  • Sequence similarities
    Contains 4 EGF-like domains.
    Contains 22 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 11 laminin EGF-like domains.
    Contains 3 laminin G-like domains.
    Contains 3 laminin IV type A domains.
    Contains 4 LDL-receptor class A domains.
    Contains 1 SEA domain.
  • Post-translational
    modifications
    Proteolytic processing produces the C-terminal angiogenic peptide, endorepellin. This peptide can be further processed to produce the LG3 peptide.
    N- and O-glycosylated; contains three heparan sulfate chains. The LG3 peptide contains at least three and up to five potential O-glycosylation sites but no N-glycosylation.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114285 at approximately 37.73kDa stained with Coomassie Blue.

References

ab114285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you very much for contacting us and for your patience. I apologise for the delay.

We have contacted the originator of the Anti-Heparan Sulfate Proteoglycan 2 antibody [A74]ab23418and enquired about epitope details. Unfortunately, there are no more details available than what is already stated on the datasheet: The epitope is located in domain V of Perlecan.

We unfortunately have only one Heparan Sulfate Proteoglycan 2 protein available in our catalog: ab114285 is a recombinant fragment of Human Heparan Sulfate Proteoglycan 2, amino acids 25-134.As thisrange of amino acids is different from domain V, ab114285 is therefore not a suitable option for your experimental setup.

We aim to provide as much information as possible to customers, so I am sorry that this has not been possible on this occasion.Please do not hesitate to contact us again with other needs or with any questions about our products.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up