Description

  • Product name

    Recombinant Human Hepatitis C Virus E2 protein (denatured)
    See all Hepatitis C Virus E2 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSERPYCWHYPPRPCG IVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPP LGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKHPEATYS RCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACN WTRGERCDLEDRDRSELSPLLLSTTQ
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      482 to 671
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human Hepatitis C Virus E2 protein

Specifications

Our Abpromise guarantee covers the use of ab180302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • Core protein
    • E1 protein
    • E2 protein
    • Envelope glycoprotein E2
    • gp68
    • gp70
    • HCV E2
    • NS1
    • NS2 protein
    • NS3 protease/helicase
    • NS4A protein
    • NS4B protein
    • NS5A protein
    • NS5B RNA dependent RNA polymerase
    • P7 protein
    • Polyprotein
    see all
  • Relevance

    Hepatitis C E2 is a virus envelope glycoprotein which forms a heterodimer with the E1 protein. E2 inhibits human EIF2AK2/PKR activation, preventing the establishment of an antiviral state. E2 is a viral ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR, which are respectively found on dendritic cells (DCs), and on liver sinusoidal endothelial cells and macrophage-like cells of lymph node sinuses. These interactions allow capture of circulating HCV particles by these cells and subsequent transmission to permissive cells. DCs are professional antigen presenting cells, critical for host immunity by inducing specific immune responses against a broad variety of pathogens. They act as sentinels in various tissues where they entrap pathogens and convey them to local lymphoid tissue or lymph node for establishment of immunity. Capture of circulating HCV particles by these SIGN+ cells may facilitate virus infection of proximal hepatocytes and lymphocyte subpopulations and may be essential for the establishment of persistent infection.
  • Cellular localization

    Viral envelope protein.

Images

  • 15% SDS-PAGE analysis of ab180302 (3 µg).

References

ab180302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up