Description

  • Product name

    Recombinant Human Hepatitis C Virus (mutated D168 V) protein
  • Purity

    >= 53 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSL TGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPV IQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVVFIP VENLETTMRS
    • Predicted molecular weight

      22 kDa including tags
    • Modifications

      mutated N168 V
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a with Asp-to-Val mutation on a.a. 168

Specifications

Our Abpromise guarantee covers the use of ab198068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.7% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • Genome polyprotein
    • HCV
    • Hepatitis C virus polyprotein
  • Relevance

    Hepatitis C Virus is a positive, single stranded RNA virus in the Flaviviridae family. The genome is approximately 10,000 nucleotides and encodes a single polyprotein of about 3,000 amino acids. The polyprotein is processed by host cell and viral proteases into three major structural proteins and several non structural proteins necessary for viral replication. Several different genotypes of HCV with slightly different genomic sequences have since been identified that correlate with differences in response to treatment with interferon alpha.
  • Cellular localization

    Virus surface

Images

  • 4-20% SDS-PAGE analysis of 1.6 µg ab198068 with Coomassie blue staining.

References

ab198068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up