Description

  • Product name

    Recombinant Human HERC4 protein
  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFL PVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVD AGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIG VICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLL DYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDA YVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDW KELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPI LGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAID HNEGFSLI
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      642 to 1049
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab167937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • DKFZP564G092
    • HECT and RLD domain containing E3 ubiquitin protein ligase 4
    • HECT domain and RCC1 like domain containing protein 4
    • HECT domain and RCC1-like domain-containing protein 4
    • Hect domain and RLD 4
    • HERC 4
    • HERC4
    • HERC4_HUMAN
    • KIAA1593
    • Probable E3 ubiquitin protein ligase HERC4
    • Probable E3 ubiquitin-protein ligase HERC4
    see all
  • Function

    Probable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.
  • Tissue specificity

    Expressed in brain and testis and detected in heart and placenta.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 7 RCC1 repeats.
  • Developmental stage

    Expressed in fetal brain.
  • Cellular localization

    Cytoplasm > cytosol. shows a punctate cytoplasmic distribution.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167937.

References

ab167937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up