Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDR LQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQ EAINNNRGFG
    • Amino acids

      915 to 1024
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as HECT E3 ubiquitin ligase.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CEB1
    • CEBP1
    • Cyclin E binding protein 1
    • Cyclin-E-binding protein 1
    • E3 ISG15--protein ligase HERC5
    • HECT domain and RCC1 like domain containing protein 5
    • HECT domain and RCC1-like domain-containing protein 5
    • Hect domain and RLD 5
    • HECT E3 ubiquitin ligase
    • HERC5
    • HERC5_HUMAN
    • Herc6
    see all
  • Function

    Major E3 ligase for ISG15 conjugation. Acts as a positive regulator of innate antiviral response in cells induced by interferon. Makes part of the ISGylation machinery that recognizes target proteins in a broad and relatively non-specific manner. Catalyzes ISGylation of IRF3 which results in sustained activation, it attenuates IRF3-PIN1 interaction, which antagonizes IRF3 ubiquitination and degradation, and boosts the antiviral response. Catalyzes ISGylation of influenza A viral NS1 which attenuates virulence; ISGylated NS1 fails to form homodimers and thus to interact with its RNA targets. Catalyzes ISGylation of papillomavirus type 16 L1 protein which results in dominant-negative effect on virus infectivity. Physically associated with polyribosomes, broadly modifies newly synthesized proteins in a cotranslational manner. In an interferon-stimulated cell, newly translated viral proteins are primary targets of ISG15.
  • Tissue specificity

    Expressed in testis and to a lesser degree in brain, ovary and placenta. Found in most tissues at low levels.
  • Sequence similarities

    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 5 RCC1 repeats.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm > perinuclear region. Associated with the polyribosomes, probably via the 60S subunit.
  • Information by UniProt

Images

  • ab162453 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up