Description

  • Product name

    Recombinant Human HERVK18.2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PQGMLNSPTICQTFVAQVLQPVRDKFSDCYIIHYVDDILCAAETRDKLID CYTFLQTEVANAGLTIASDKIQTSTPFHYLGMQVEERKIKPQKVEIRKDT LRTLNDFKNC
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      88 to 197
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Envelope polyprotein
    • HERV-K(C1a) envelope protein
    • HERV-K_1q23.3 provirus ancestral Env polyprotein
    • HERV-K110 envelope protein
    • HERV-K18 envelope protein
    • HERV-K18 superantigen
    • IDDMK1,2 22 envelope protein
    • IDDMK1,2 22 superantigen
    see all
  • Relevance

    HERVK18.2 is a retroviral envelope protein. These proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This envelope protein has superantigenic properties. It is expressed at higher level in the thymus. It is expressed at lower level in peripheral blood lymphocytes.

Images

  • 12.5% SDS-PAGE showing ab114906 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References

ab114906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up