Overview

  • Product name

    Recombinant Human HES6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRL LLAGAEVQAKLENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGY IQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSSFQDLLGDALA GPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEG PDLVPAALGSLTTAQIARSVWRPW
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 224

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bHLHb41
    • bHLHc23
    • C HAIRY1
    • Class B basic helix-loop-helix protein 41
    • Hairy and enhancer of split 6
    • Hairy/enhancer of split 6, Drosophila, homolog of, 6
    • HES 6
    • hes family bHLH transcription factor 6
    • Transcription cofactor HES6
    see all
  • Relevance

    HES6 is a transcription cofactor that iteself does not bind to DNA but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. It also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCFEA2/E47, allowing ASCL1 and TCFEA2 to upregulate transcription in its presence. HES6 appears to have novel functions in tumour and cancer cell lines, although these have not yet been elucidated fully.
  • Cellular localization

    Nuclear

Images

  • ab132389 on 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up