Overview

  • Product name

    Recombinant Human HES7 protein (denatured)
  • Protein length

    Full length protein
  • Description

    Recombinant Human HES7 protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVTRDRAENRDGPKMLKPLVEKRRRDR INRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPAA AAPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSAL HGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPR CAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWR PWP
    • Molecular weight

      27 kDa including tags
    • Amino acids

      1 to 230
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • bHLH factor Hes7
    • bHLHb37
    • Class B basic helix loop helix protein 37
    • Class B basic helix-loop-helix protein 37
    • Hairy and enhancer of split 7
    • hes family bHLH transcription factor 7
    • Hes7
    • HES7_HUMAN
    • hHes7
    • SCDO4
    • Transcription factor HES 7
    • Transcription factor HES-7
    see all
  • Function

    Transcriptional repressor. Represses transcription from both N box- and E box-containing promoters. May with HES1, cooperatively regulate somite formation in the presomitic mesoderm (PSM). May function as a segmentation clock, which is essential for coordinated somite segmentation.
  • Involvement in disease

    Defects in HES7 are the cause of spondylocostal dysostosis type 4 (SCDO4) [MIM:613686]. A rare condition of variable severity characterized by vertebral and costal anomalies. The main feature include dwarfism, vertebral fusion, hemivertebrae, posterior rib fusion, reduced rib number, and other rib malformations.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 Orange domain.
  • Domain

    Has a particular type of basic domain which includes a helix-interrupting proline.
    The C-terminal WRPW motif is a transcriptional repression motif which is necessary for interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137139.

References

ab137139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up