Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCS SSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLK RELSWYRGRR
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ANF
    • CPHD5
    • hANF
    • HESX homeobox 1
    • Homeobox ES cell expressed 1
    • Homeobox expressed in ES cells 1
    • Homeobox protein ANF
    • Rathke pouch homeobox
    • RPX
    see all
  • Relevance

    Homeobox protein expressed in embryonic stem cells and targetd by Sox2, Oct4 and Nanog. Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor.
  • Cellular localization

    Nuclear

Images

  • ab160211 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up