Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      29 amino acid tag-QYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTP APTLPSPNSSFTSLVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFG GPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSND QTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQ ENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLE SEISEDSDQEVDIEGDKSYFNAGLEESGGGGSPGRRRRRRRRRRR
    • Molecular weight

      30 kDa
    • Amino acids

      2 to 270

Associated products

Specifications

Our Abpromise guarantee covers the use of ab134846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Cell differentiation

  • Purity

    > 90 % SDS-PAGE.
    ab134846 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains a proprietary formulation of NaCl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names

    • Hematopoietically expressed homeobox
    • Hematopoietically-expressed homeobox protein HHEX
    • HEX
    • HHEX
    • HHEX_HUMAN
    • HMPH
    • Homeobox hematopoietically expressed
    • Homeobox protein HEX
    • Homeobox protein PRH
    • HOX11L PEN
    • PRH
    • PRHX
    • Proline rich homeodomain containing transcription factor
    see all
  • Function

    Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.
  • Tissue specificity

    Liver and promyelocytic leukemia cell line HL60.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Expressed during hematopoiesis.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up