Overview

  • Product name

    Recombinant Human HEXO protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKG SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD VLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHE IIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRA DTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKY PPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
    • Molecular weight

      67 kDa including tags
    • Amino acids

      1 to 349

Specifications

Our Abpromise guarantee covers the use of ab132251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3' 5' exonuclease ERI 1
    • 3' 5' exonuclease ERI1
    • 3' EXO
    • 3' exoribonuclease
    • 3' HEXO
    • 3' histone mRNA exonuclease 1
    • 3''-5'' exonuclease eri1
    • 3''-5'' exoribonuclease 1
    • 3'EXO
    • 3'HEXO
    • ERI 1
    • Eri 1 homolog
    • Eri-1 homolog
    • eri1
    • Eri1 homolog
    • ERI1_HUMAN
    • HEXO
    • Histone mRNA 3' end specific exonuclease
    • Histone mRNA 3' end specific exoribonuclease
    • Histone mRNA 3''-end-specific exoribonuclease
    • Histone mRNA 3''-exonuclease 1
    • MGC35395
    • Protein 3''hExo
    • THEX 1
    • THEX1
    • Three prime histone mRNA exonuclease 1
    see all
  • Function

    RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.
  • Sequence similarities

    Contains 1 exonuclease domain.
    Contains 1 SAP domain.
  • Domain

    The SAP domain is necessary for binding to the stem-loop structure of histone mRNAs and to form the ternary complex with SLBP, but not for 3'-end histone mRNA exonuclease activity.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132251 stained with Coomassie Blue.

References

ab132251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up