Bioactive grade

Recombinant human Hexokinase II protein (Active) (ab235131)

Description

  • Product name

    Recombinant human Hexokinase II protein (Active)
    See all Hexokinase II proteins and peptides
  • Biological activity

    Specific activity is > 40,000 pmol/min/µg. One unit will convert 1 pmoles of D-Glucose to D-Glucose-6-phosphate per minute at pH 8.0 at 37°C. 

  • Purity

    > 90 % SDS-PAGE.
    ab235131 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMIASHLLAYFFTELNHDQVQKVDQYLYHMR LSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEF LALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHI AECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIV GTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQE IDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLN TGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVST RSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKT VRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLA LDLGGTNFRVLLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQ CIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEG EDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGT GSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDDFRTEFDVAVD ELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRA AQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVK DLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
    • Predicted molecular weight

      105 kDa including tags
    • Amino acids

      1 to 917
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000180.

Specifications

Our Abpromise guarantee covers the use of ab235131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DKFZp686M1669
    • Hexokinase 2
    • Hexokinase 2 muscle
    • Hexokinase type II
    • Hexokinase-2
    • HK 2
    • HK II
    • HK2
    • HKII
    • HxK 2
    • HxK2
    • HXK2_HUMAN
    • Muscle form hexokinase
    see all
  • Tissue specificity

    Predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle.
  • Pathway

    Carbohydrate metabolism; hexose metabolism.
  • Sequence similarities

    Belongs to the hexokinase family.
    Contains 2 hexokinase domains.
  • Domain

    The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus. Each domain can bind a single glucose and Gluc-6-P molecule.
  • Cellular localization

    Mitochondrion outer membrane. Its hydrophobic N-terminal sequence may be involved in membrane binding.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab235131.

References

ab235131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up