Description

  • Product name

    Recombinant Human Hexokinase Type III/HK3 protein
    See all Hexokinase Type III/HK3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQI QASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATG ASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEF LDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQ LLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNAC YMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLN PGAQRFEKMIGGLYLGELVRLVLAH LARCGVLFGGCTSPALLSQGSILLEHVAEMEDPSTGAARVHAILQDLGLS PGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQVAVAT GGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAAR LAAHRRLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTF VRATPDGSERGDFLALDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQG SGQQLFDHIVDCIVDFQQKQGLSGQSLPLGFTFSFPCRQLGLDQGILLNW TKGFKASDCEGQDVVSLLREAITRRQAVELNVVAIVNDTVGTMMSCGYED PRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGDDGSLA MLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFR GQQIQRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMV LEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHP RFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALVTAVACRLAQLTRVLE HHHHHH
    • Predicted molecular weight

      100 kDa including tags
    • Amino acids

      1 to 923
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Hexokinase Type III

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

General Info

  • Alternative names

    • ATP:D hexose 6 phosphotransferase
    • Hexokinase type III
    • Hexokinase-3
    • Hexokinase3
    • HK III
    • Hk3
    • HKIII
    • HXK3
    • HXK3_HUMAN
    see all
  • Pathway

    Carbohydrate metabolism; hexose metabolism.
  • Sequence similarities

    Belongs to the hexokinase family.
  • Domain

    The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus.
  • Information by UniProt

References

ab185851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up