Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKC WEPLKSHFTPNSRNPAEPN
    • Amino acids
      377 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-dioxygenase
    • AKU
    • FLJ94126
    • hgd
    • HGD_HUMAN
    • HGO
    • Homogentisate 1
    • Homogentisate 1 2 dioxygenase
    • Homogentisate oxidase
    • Homogentisate oxygenase
    • Homogentisic acid oxidase
    • Homogentisicase
    see all
  • Tissue specificity
    Highest expression in the prostate, small intestine, colon, kidney and liver.
  • Pathway
    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6.
  • Involvement in disease
    Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis.
  • Sequence similarities
    Belongs to the homogentisate dioxygenase family.
  • Information by UniProt

Images

  • ab158652 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up