Description

  • Product name

    Recombinant Human HGD protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFT CPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPF EIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNS DGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYI LEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQ GKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTV LTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMF ESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 445
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 2-dioxygenase
    • AKU
    • FLJ94126
    • hgd
    • HGD_HUMAN
    • HGO
    • Homogentisate 1
    • Homogentisate 1 2 dioxygenase
    • Homogentisate oxidase
    • Homogentisate oxygenase
    • Homogentisic acid oxidase
    • Homogentisicase
    see all
  • Tissue specificity

    Highest expression in the prostate, small intestine, colon, kidney and liver.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6.
  • Involvement in disease

    Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis.
  • Sequence similarities

    Belongs to the homogentisate dioxygenase family.
  • Information by UniProt

Images

  • ab239441 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up