Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLP FTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIG KGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPR GEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKI CQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWE YCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDS QYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIP NCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPD ASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLD HPVISCAKTKQLR
    • Amino acids
      32 to 494
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature Protein without signal peptide of HGF alpha chain.

Specifications

Our Abpromise guarantee covers the use of ab166881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 50% Glycerol
    Note: Buffered with Tris or PBS.

General Info

  • Alternative names
    • DFNB39
    • F TCF
    • Fibroblast derived tumor cytotoxic factor
    • Hepatocyte growth factor
    • Hepatocyte growth factor (hepapoietin A; scatter factor)
    • Hepatocyte growth factor beta chain
    • Hepatocyte growth factor precursor
    • Hepatopoietin A
    • Hepatopoietin-A
    • Hgf
    • HGF_HUMAN
    • HGFB
    • HPTA
    • Lung fibroblast derived mitogen
    • OTTHUMP00000161349
    • OTTHUMP00000206710
    • OTTHUMP00000206711
    • OTTHUMP00000206712
    • OTTHUMP00000206713
    • OTTHUMP00000206730
    • Scatter factor
    • SF
    see all
  • Function
    Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
  • Involvement in disease
    Deafness, autosomal recessive, 39
  • Sequence similarities
    Belongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • ab166881 is >95% pure by SDS-PAGE.

References

ab166881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up