Overview

  • Product name

    Recombinant Human HGF protein (denatured)
    See all HGF proteins and peptides
  • Protein length

    Full length protein
  • Description

    Recombinant Human HGF protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQRKRRNTIHEFKKSAKTTLIKIDPALKIK TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKK EFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEH SYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCN GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG QPRPWCYTLDPHTRWEYCAI KTCET
    • Molecular weight

      30 kDa
    • Amino acids

      32 to 285
    • Additional sequence information

      Mature sequence of Isoform 5 (NP_001010933).

Specifications

Our Abpromise guarantee covers the use of ab181970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 80 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • DFNB39
    • F TCF
    • Fibroblast derived tumor cytotoxic factor
    • Hepatocyte growth factor
    • Hepatocyte growth factor (hepapoietin A; scatter factor)
    • Hepatocyte growth factor beta chain
    • Hepatocyte growth factor precursor
    • Hepatopoietin A
    • Hepatopoietin-A
    • Hgf
    • HGF_HUMAN
    • HGFB
    • HPTA
    • Lung fibroblast derived mitogen
    • OTTHUMP00000161349
    • OTTHUMP00000206710
    • OTTHUMP00000206711
    • OTTHUMP00000206712
    • OTTHUMP00000206713
    • OTTHUMP00000206730
    • Scatter factor
    • SF
    see all
  • Function

    Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
  • Involvement in disease

    Deafness, autosomal recessive, 39
  • Sequence similarities

    Belongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181970 (3µg).

References

ab181970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up