Description

  • Product name

    Recombinant Human HGFA Inhibitor 2 protein
    See all HGFA Inhibitor 2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNN YLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMF NYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEE ACMLRCFRQQENPPLPLGSKVDHHHHHH
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      28 to 197
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles

General Info

  • Alternative names

    • AL024025
    • Bikunin, placental
    • C76321
    • DIAR3
    • FLJ45571
    • HAI-2
    • HAI2
    • Hepatocyte growth factor activator inhibitor type 2
    • Kop
    • Kunitz type protease inhibitor 2
    • Kunitz-type protease inhibitor 2
    • Kunitz-type serine protease inhibitor
    • MGC72638
    • PB
    • Placental bikunin
    • Serine peptidase inhibitor Kunitz type 2
    • Serine protease inhibitor, Kunitz type, 2
    • SPINT2
    • SPIT2_HUMAN
    see all
  • Function

    Inhibitor of HGF activator. Also inhibits plasmin, plasma and tissue kallikrein, and factor XIa.
  • Tissue specificity

    Expressed in placenta, kidney, pancreas, prostate, testis, thymus, and trachea.
  • Involvement in disease

    Defects in SPINT2 are the cause of diarrhea type 3 (DIAR3) [MIM:270420]; also known as congenital sodium diarrhea (CSD). DIAR3 is a rare, inherited diarrhea of infancy. A diagnosis of DIAR3 is made on the findings of a life-threatening secretory diarrhea, severe metabolic acidosis, and hyponatremia secondary to extraordinarily high fecal losses of sodium, with low or normal excretion of urinary sodium, in the absence of infectious, autoimmune, and endocrine causes.
  • Sequence similarities

    Contains 2 BPTI/Kunitz inhibitor domains.
  • Domain

    This inhibitor contains two inhibitory domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab153796.
    Predicted MW 20 kDa.

References

ab153796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up