Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIK KKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQV EVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDA MFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTI PKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPP KRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSA PVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGE SEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMH PQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAE EAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQ KQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQA QAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQ SVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQ QQPPVAQQPQAQGPPAQGSEAQLISFD
    • Molecular weight

      113 kDa including tags
    • Amino acids

      1 to 777

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Hepatocyte growth factor regulated tyrosine kinase substrate
    • Hepatocyte growth factor-regulated tyrosine kinase substrate
    • HGF-regulated tyrosine kinase substrate
    • HGNC:4897
    • HGS
    • HGS_HUMAN
    • Hrs
    • Human growth factor regulated tyrosine kinase substrate
    • Protein pp110
    • ZFYVE8
    see all
  • Function

    Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation.
  • Tissue specificity

    Ubiquitous expression in adult and fetal tissues with higher expression in testis and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
    Contains 1 VHS domain.
  • Domain

    Has a double-sided UIM that can bind 2 ubiquitin molecules, one on each side of the helix.
    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Post-translational
    modifications

    Phosphorylated on Tyr-334. A minor site of phosphorylation on Tyr-329 is detected (By similarity). Phosphorylation occurs in response to EGF, IL-2, GM-CSF and HGF.
    Ubiquitinated by ITCH.
  • Cellular localization

    Cytoplasm. Early endosome membrane. Endosome > multivesicular body membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132524 stained with Coomassie Blue.

References

ab132524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up