Description

  • Product name

    Recombinant Human Hhip protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCG GFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
    • Amino acids

      21 to 120
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20992
    • FLJ90230
    • Hedgehog interacting protein
    • Hedgehog-interacting protein
    • hedgehoginteracting protein
    • HHIP
    • HHIP_HUMAN
    • Hip
    see all
  • Function

    Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.
  • Tissue specificity

    Widely expressed in fetal and adult tissues. Highest expression in adult heart, liver and pancreas, and in fetal kidney.
  • Sequence similarities

    Belongs to the HHIP family.
    Contains 2 EGF-like domains.
  • Domain

    A flexible loop interacts with the SHH zinc binding site and contributes to zinc binding.
  • Cellular localization

    Cytoplasm and Cell membrane. Secreted. The last 22 C-terminal amino acids may participate in cell membrane attachment.
  • Information by UniProt

Images

  • ab153485 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up