Overview

  • Product name

    Recombinant Human HIF1 beta protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFD DDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERR RRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQP QSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQ SSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFC HPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLA PRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFA QDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQ QVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
    • Amino acids

      1 to 789
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • arnT
    • ARNT protein
    • ARNT_HUMAN
    • Aryl hydrocarbon receptor nuclear translocator
    • bHLHe2
    • Class E basic helix-loop-helix protein 2
    • Dioxin receptor
    • Dioxin receptor nuclear translocator
    • Drnt
    • HIF 1 beta
    • HIF 1beta
    • HIF-1-beta
    • HIF1-beta
    • HIF1B
    • HIF1beta
    • Hypoxia Inducible Factor 1
    • Hypoxia inducible factor 1 beta
    • Hypoxia-inducible factor 1-beta
    • nuclear translocator
    • Tango
    see all
  • Function

    Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab157907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up