Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFD DDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERR RRNKMTAYIT
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • arnT
    • ARNT protein
    • ARNT_HUMAN
    • Aryl hydrocarbon receptor nuclear translocator
    • bHLHe2
    • Class E basic helix-loop-helix protein 2
    • Dioxin receptor
    • Dioxin receptor nuclear translocator
    • Drnt
    • HIF 1 beta
    • HIF 1beta
    • HIF-1-beta
    • HIF1-beta
    • HIF1B
    • HIF1beta
    • Hypoxia Inducible Factor 1
    • Hypoxia inducible factor 1 beta
    • Hypoxia-inducible factor 1-beta
    • nuclear translocator
    • Tango
    see all
  • Function
    Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab157908 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up