Description

  • Product name

    Recombinant Human HIP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINT QEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFH KLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKM EYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCL PADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLR ASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDI FGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQR VVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKA QRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMAR QAQVDLEREKKELEDSLERISDQGQRKTQEQLEVLESLKQELATSQRELQ VLQGSLETSAQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQD TQLKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISC AGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTS DAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADS TAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATAR IEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVE SGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKF EELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVV ASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQK LGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
    • Predicted molecular weight

      140 kDa including tags
    • Amino acids

      1 to 1037

Specifications

Our Abpromise guarantee covers the use of ab114964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as Huntingtin Interacting Protein HIP1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610109B09Rik
    • A930014B11Rik
    • E130315I21Rik
    • HIP 1
    • HIP I
    • HIP-1
    • HIP-I
    • hip1
    • HIP1/PDGFRB fusion gene
    • HIP1/PDGFRB fusion gene, included
    • HIP1_HUMAN
    • HIPI
    • Huntingtin interacting protein 1
    • Huntingtin Interacting Protein HIP1
    • Huntingtin-interacting protein 1
    • Huntingtin-interacting protein I
    • ILWEQ
    • KIAA4113
    • MGC126506
    • MGC27616
    • mKIAA4113
    see all
  • Function

    Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors.
  • Tissue specificity

    Ubiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer.
  • Involvement in disease

    Note=A chromosomal aberration involving HIP1 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;7)(q33;q11.2) with PDGFRB. The chimeric HIP1-PDGFRB transcript results from an in-frame fusion of the two genes. The reciprocal PDGFRB-HIP1 transcript is not expressed.
  • Sequence similarities

    Belongs to the SLA2 family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 1 I/LWEQ domain.
  • Domain

    The pseudo DED region (pDED) mediates the interaction with IFT57.
    Binds F-actin via the talin-like I/LWEQ domain.
  • Cellular localization

    Cytoplasm. Nucleus. Endomembrane system. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Shuttles between cytoplasm and nucleus. Nuclear translocation can be induced by AR.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114964 at approximately 140.14kDa.
    Stained with Coomassie Blue.

References

ab114964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up