Overview

  • Product name

    Recombinant Human HIP14 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRK THIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAIN NRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADP SLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYR THSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGAN VDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFF DHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFY NFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPVRS KHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWMIYGC ISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLM CQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
    • Amino acids

      1 to 632
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ZDHHC17

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DHHC 17
    • DHHC domain containing 17
    • HIP14
    • HIP3
    • HSPC294
    • huntingtin interacting protein 14
    • huntingtin interacting protein 3
    • Huntingtin interacting protein H
    • HYPH
    • KIAA0946
    • Putative MAPK activating protein PM11
    • Putative NF kappa B activating protein 205
    • ZDHHC 17
    • zinc finger
    • Zinc finger DHHC domain containing 17
    • Zinc finger DHHC domain containing protein 17
    • Zinc finger DHHC type containing 17
    see all
  • Relevance

    ZDHHC17 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.
  • Cellular localization

    Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Images

  • ab161618 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up