Description

  • Product name

    Recombinant Human HIP1R protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKH ARRIILGTHHEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPN VLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTKISFHLKHPQF PAGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTA IAVSQMSSGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHR DRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHIK PVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKD DRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRK QKQKALVDNEQLRHELAQLRAAQLEGERSQGLREEAERKASATEARYNKL KEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQVEQVK RESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLD TLSAEKDALSGAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQG RLAERESQEQGLRQRLLDEQFAVLRGAAAEAAGILQDAVSKLDDPLHLRC TSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAA DTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQA SLVRTPLQGILQLGQELKPKSLDVRQEELGAVVDKEMAATSAAIEDAVRR IEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKEIVE SGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKY EELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVV ASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMR LGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQ DHQLDKKDGIYPAQLVNY
    • Predicted molecular weight

      146 kDa including tags
    • Amino acids

      1 to 1068

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ14000
    • FLJ27022
    • HIP-12
    • Hip1 related
    • HIP1-related protein
    • HIP12
    • HIP1R
    • HIP1R_HUMAN
    • HIP3
    • Huntingtin Interacting Protein 1 Related
    • Huntingtin interacting protein 12
    • Huntingtin-interacting protein 1-related protein
    • Huntingtin-interacting protein 12
    • ILWEQ
    • KIAA0655
    • MGC47513
    see all
  • Function

    Component of clathrin-coated pits and vesicles, that may link the endocytic machinery to the actin cytoskeleton. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis.
  • Tissue specificity

    Brain, heart, kidney, pancreas, and liver, but not in lung or placenta.
  • Sequence similarities

    Belongs to the SLA2 family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 1 I/LWEQ domain.
  • Domain

    Binds F-actin via the talin-like I/LWEQ domain.
  • Cellular localization

    Cytoplasm > perinuclear region. Endomembrane system. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Membrane-associated protein, mainly localized at the endocytic compartments and in the perinuclear region.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131891 at approximately 145.8 kDa.

References

ab131891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up