Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGL EEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASH VSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQ DVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEE AQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNE QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLV QQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITG IEVIDEGWWRGYGPDGHFGMFPANYVELIE
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 430

Specifications

Our Abpromise guarantee covers the use of ab131883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABP1
    • Actin-binding protein 1
    • Cervical mucin associated protein
    • Cervical mucin-associated protein
    • Cervical SH3P7
    • CMAP
    • Dbnl
    • DBNL_HUMAN
    • Drebrin F
    • drebrin like
    • Drebrin like protein
    • Drebrin-F
    • Drebrin-like protein
    • HIP 55
    • HIP-55
    • HPK1 interacting protein of 55 kDa
    • HPK1-interacting protein of 55 kDa
    • SH3 domain containing protein 7
    • SH3 domain-containing protein 7
    • SH3P7
    • src homology 3 domain containing protein HIP 55
    see all
  • Function

    Actin-binding adapter protein. May act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes. Binds to F-actin but is not involved in actin polymerization, capping or bundling. Does not bind G-actin.
  • Sequence similarities

    Belongs to the ABP1 family.
    Contains 1 ADF-H domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain mediates interaction with SHANK2, SHANK3 and PRAM1.
  • Post-translational
    modifications

    Degraded by caspases during apoptosis.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cortical cytoskeleton. Associates with lamellipodial actin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131883 at approximately 73.04 kDa.

References

ab131883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up