Description

  • Product name

    Recombinant Human Hippocalcin protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKK IYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQK LMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTE KIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 193

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BDR 2
    • BDR2
    • Calcium binding protein BDR 2
    • Calcium binding protein BDR2
    • Calcium-binding protein BDR-2
    • HPCA
    • HPCA_HUMAN
    • Neuron specific calcium binding protein hippocalcin
    • Neuron-specific calcium-binding protein hippocalcin
    • P23K
    see all
  • Function

    May be involved in the calcium-dependent regulation of rhodopsin phosphorylation. Binds two calcium ions.
  • Tissue specificity

    Brain specific.
  • Sequence similarities

    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Post-translational
    modifications

    Myristoylation facilitates interaction with membranes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132300.

References

ab132300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up